PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c3_13480V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NF-YB
Protein Properties Length: 224aa    MW: 24947 Da    PI: 6.1604
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c3_13480V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB84.99.2e-273280149
              NF-YB  1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtse 49
                       vreqdrflPian+srimkk+lPanaki+kdaketvqecvsefisf+ts+
  Pp3c3_13480V3.1.p 32 VREQDRFLPIANISRIMKKALPANAKIAKDAKETVQECVSEFISFITSD 80
                       69*********************************************86 PP

2NF-YB82.55.2e-261251734896
              NF-YB  48 seasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                        + asdkcqrekrktingddllwa++tlGfedyveplkvyl+kyre+eg+
  Pp3c3_13480V3.1.p 125 NRASDKCQREKRKTINGDDLLWAMSTLGFEDYVEPLKVYLHKYREIEGA 173
                        579*******************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471133.05E-171780IPR009072Histone-fold
Gene3DG3DSA:1.10.20.102.4E-252879IPR009072Histone-fold
PfamPF008081.2E-153879IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.9E-186684No hitNo description
SuperFamilySSF471136.52E-18122187IPR009072Histone-fold
Gene3DG3DSA:1.10.20.102.0E-22125187IPR009072Histone-fold
PfamPF008081.1E-4125148IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.9E-18131149No hitNo description
PRINTSPR006151.9E-18150168No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MAEAGSPGSQ DSPHSDEYGG NHGGGDRDNS SVREQDRFLP IANISRIMKK ALPANAKIAK  60
DAKETVQECV SEFISFITSD LLSFMWSHVY DAISPFEWHL VLLPPFLGRF TELEGDTMVR  120
KHAMNRASDK CQREKRKTIN GDDLLWAMST LGFEDYVEPL KVYLHKYREI EGALTNKAGE  180
SSSGKKEGSN IVSPGVQMVQ QGGYNPYMQA QMMTSGNYQV QHY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B5e-3932169192Transcription factor HapC (Eurofung)
4g91_B5e-3932169192Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.109072e-78protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0198982e-83EU019898.1 Physcomitrella patens CCAAT-box binding factor HAP3-like protein (HAP3E) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001756878.15e-79predicted protein
SwissprotO233101e-57NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0I9QPW31e-121A0A0I9QPW3_PHYPA; CCAAT-box binding factor HAP3-like protein
STRINGPP1S25_10V6.11e-134(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.15e-58nuclear factor Y, subunit B3